+ :i24^RIt^RIt^RIt^RIHt^RIHt^RIHt^RI H t ^RI H t ^RI Ht!RR4t!R R 4t]!R .RO4tR t!R R4t]!RRR.4t!RR]4tR#)N) namedtuple)Sequence)contextmanager)cached_property)configc<a]tRt^toRtR.tRtRtRtRt Vt R#)RecordLLVMPassTimingsLegacy9A helper context manager to track LLVM pass timings. _datac 2\P!R4V#))Enables the pass timing in LLVM. T)llvmset_time_passesselfs&Z/var/www/html/photoedit/myenv/lib/python3.14/site-packages/numba/misc/llvm_pass_timings.py __enter__%RecordLLVMPassTimingsLegacy.__enter__s T" c f\P!4Vn\P!R4R#)2Reset timings and save report internally. FN)rreport_and_reset_timingsr rrexc_valexc_typeexc_tbs&&&&r__exit__$RecordLLVMPassTimingsLegacy.__exit__s%224  U#rc ,\VP4#zTRetrieve timing data for processing. Returns ------- timings: ProcessedPassTimings ProcessedPassTimingsr rs&rgetRecordLLVMPassTimingsLegacy.get!$DJJ//r)r N) __name__ __module__ __qualname____firstlineno____doc__ __slots__rrr#__static_attributes____classdictcell__ __classdict__s@rr r s' I 00rr cDa]tRt^+toRtRR.tRtRtRtRt Rt Vt R #) RecordLLVMPassTimingsr r _pbc WnRVnR#N)r2r )rpbs&&r__init__RecordLLVMPassTimings.__init__1s rc :VPP4V#)r )r2start_pass_timingrs&rrRecordLLVMPassTimings.__enter__5s ""$ rc DVPP4VnR#)rN)r2finish_pass_timingr rs&&&&rrRecordLLVMPassTimings.__exit__;sXX002 rc ,\VP4#r r!rs&rr#RecordLLVMPassTimings.getAr%r)r r2N) r&r'r(r)r*r+r6rrr#r,r-r.s@rr1r1+s/% I  00rr1PassTimingRecordcaaVR,oSPR8XgQhV3RlpRUu.uF q!!V4NK upo\RV4pV3Rlp\\WC44#uupi)zAdjust timing records because of truncated information. Details: The percent information can be used to improve the timing information. Returns ------- res: List[PassTimingRecord] Totalc`<aaaV R2oV R2o\P!S4oVVVV3RlpV#)_time_percentcL<S!S4pWS,,R,pW S&V#)z'Compute percent x total_time = adjustedg{Gz?)dtotaladjusted percent_attr time_attr time_getter total_recs& radjust6_adjust_timings..make_adjuster..adjustns* *E.5H#iLHr)operator attrgetter)attrrOrKrLrMrNs& @@@r make_adjuster&_adjust_timings..make_adjusteris;fEN x( )))4    rc"VP4#r4)_asdictxs&r!_adjust_timings..}s !))+rc<<SF pV!V4pK \R/VB#)NrG)r@)rHfnadj_fnss& rchained _adjust_timings..chaineds&B1A $!$$r)usersystem user_systemwall) pass_namemaplist)recordsrTrYdictsr_r^rNs& @@r_adjust_timingsrk\st I   ' )) )  #L"KQ a"KG %w /E% G# $$sA#cha]tRt^toRtRtRtRtRtRt Rt R Rlt ] R 4t R tR tVtR #)r"zA class for processing raw timing report from LLVM. The processing is done lazily so we don't waste time processing unused timing information. cWnR#r4 _raw_data)rraw_datas&&rr6ProcessedPassTimings.__init__s!rc,\VP4#r4)boolrors&r__bool__ProcessedPassTimings.__bool__sDNN##rc VP#)z7Returns the raw string data. Returns ------- res: str rnrs&r get_raw_data!ProcessedPassTimings.get_raw_datas~~rc DVP4R,P#)zHCompute the total time spend in all passes. Returns ------- res: float ra) list_records wall_timers&rget_total_time#ProcessedPassTimings.get_total_times  "2&000rc VP#)z[Get the processed data for the timing report. Returns ------- res: List[PassTimingRecord] ) _processedrs&rrz!ProcessedPassTimings.list_recordssrc VP4p\P!R4p\P!WRRV4#)aGReturns the top(n) most time-consuming (by wall-time) passes. Parameters ---------- n: int This limits the maximum number of items to show. This function will show the ``n`` most time-consuming passes. Returns ------- res: List[PassTimingRecord] Returns the top(n) most time-consuming passes in descending order. r{Nra)rzrQrRheapqnlargest)rnrikeys&& rlist_topProcessedPassTimings.list_tops9##%!!+.~~a"s33rc  $aa.oRV,oVV3RlpV!RVP4R R24V!R4VPV4F4pV!RVPR RVPR R VP 24K6 R P S4#) aJReturn a string summarizing the timing information. Parameters ---------- topn: int; optional This limits the maximum number of items to show. This function will show the ``topn`` most time-consuming passes. indent: int; optional Set the indentation level. Defaults to 0 for no indentation. Returns ------- res: str  c2<SPS V 24R#r4)append)argbufprefixs&rap(ProcessedPassTimings.summary..aps JJ&#' (rzTotal .4fsz Top timings:z zs (5z%)  )r|rr{ wall_percentrfjoin)rtopnindentrprrs&&& @@rsummaryProcessedPassTimings.summarysv ) VD'')#.a 01 >t$A AKK$Cq'9Q[[MJ K%yy~rc "VP4#)zdA cached property for lazily processing the data and returning it. See ``_process()`` for details. )_processrs&rrProcessedPassTimings._processeds }}rc TRp\V!VP44p\V4#)zParses the raw string data from LLVM timing report and attempts to improve the data by recomputing the times (See `_adjust_timings()``). c 3F"VP4pRpRV R2p\V4pRRRRRR R R R R RR/pVF_p\P!W64pV'gK#\P!RV4pVU u.uFqV P 4,NK p p M X R,R8XgQh.p Rp Rp V RRFLp V R 8Xd W, p KV P V R24V P V R24V RV RV R2, p KN /p\PFp W9gK V R8wgKRW&K V R, p VFp\P!W4pVfK\VP44p\W4U Uu/uFwrYe \V4MRbK pp pVPV4VR,p\R RV/VBpVxVPR8XgKM RPV4pRV9dR#V'd\!RV 24hR#uup iuupp i5i)!z_A generator that parses the raw_data line-by-line to extract timing information for each pass. z [a-zA-Z+ ]+z(?:\s*-+z-+)+z User Timerbz System Timercz User+Systemrdz Wall TimereInstr instructionNamerfz[a-zA-Z][a-zA-Z+ ]+z\s*((?:[0-9]+\.)?[0-9]+)NrDrEz\s+(?:z\s*\(z%\)|-+)gz\s*(.*)rBrz Analysis execution timing reportz'unexpected text after parser finished: rarG) splitlinesiterrematchfindallstriprr@_fieldsrhgroupszipfloatupdaterfr ValueError)rplines colheadermulticolheaders line_iter header_maplnm raw_headerskheadersattrsrpatmissingvdatarfrec remainings& rparse,ProcessedPassTimings._process..parsesN'')E&I!))D9OU IVx}V J HH_11"$**-CR"HK>IJk!'')44kGJ  2;+- --E+ACSb\ %HCLLA3e-LLA3h0fQCuQCw77C "G%-->a;&6!$GJ. : CHHS%=#AHHJ/H(+E(<>(<=uQxcA(<>KK( ( I*"+/3CI}}/  ),I2Y> >ykJ[K6>sCAH!H!4HB H!!H!*-H!'H!Hz|A collection of pass timings. This class implements the ``Sequence`` protocol for accessing the individual timing records. c Wn.VnR#r4_name_records)rrs&&rr6PassTimingsCollection.__init__Es  rc# "\P'dM\4;_uu_4pRxRRR4XP4pV'dVP W4R#R#RxR# +'giLC;i5i)zRecord new timings and append to this collection. Note: this is mainly for internal use inside the compiler pipeline. See also ``RecordLLVMPassTimingsLegacy`` Parameters ---------- name: str Name for the records. N)rLLVM_PASS_TIMINGSr r#_append)rrrrs&& r record_legacy#PassTimingsCollection.record_legacyIsR  # # #,..'/++-C T' /.s!)A>A+A>A>+ A; 6A>c# "\P'dN\V4;_uu_4pRxRRR4XP4pV'dVP W4R#R#RxR# +'giLC;i5i)zRecord new timings and append to this collection. Note: this is mainly for internal use inside the compiler pipeline. See also ``RecordLLVMPassTimings`` Parameters ---------- name: str Name for the records. N)rrr1r#r)rrr5rrs&&& rrecordPassTimingsCollection.recordbsT  # # #&r**g+++-C T' +*s!*A?A,A?A?, A< 7A?c NVPP\W44R#)zAppend timing records Parameters ---------- name: str Name for the records. timings: ProcessedPassTimings the timing records. N)rrr)rrrs&&&rrPassTimingsCollection._append{s \$89rc bVP'd\RVP44#R#)zComputes the sum of the total time across all contained timings. Returns ------- res: float or None Returns the total number of seconds or None if no timings were recorded c3T"TFqPP4xK R#5ir4rr|).0rs& r 7PassTimingsCollection.get_total_time..sI=ayy//11=s&(N)rsumrs&rr|$PassTimingsCollection.get_total_times% ===I4==II Irc 4\VPRRR7#)zqReturns the timings in descending order of total time duration. Returns ------- res: List[ProcessedPassTimings] c6VPP4#r4rrXs&rrZ:PassTimingsCollection.list_longest_first..sAII$<$<$>rT)rreverse)sortedrrs&rlist_longest_first(PassTimingsCollection.list_longest_firstsdmm>"$ $rc $VP'*#)z rrs&ris_emptyPassTimingsCollection.is_emptys==  rc VP'dR#.pVPpV!RVP 24VP4pV!RVR 24\ VP 4FuwrVV!RV RVP 24VPP4V, ^d,pV!RVR R 24V!VPPV^R 74Kw R PV4#) a1Return a string representing the summary of the timings. Parameters ---------- topn: int; optional, default=5. This limits the maximum number of items to show. This function will show the ``topn`` most time-consuming passes. Returns ------- res: str See also ``ProcessedPassTimings.summary()`` zNo pass timings were recordedzPrinting pass timings for z Total time: rz== #rz Percent: z.1f%)rrr) rrrr| enumeraterrrrr)rrrr overall_timeirpercents&& rrPassTimingsCollection.summarys ===2CB +DJJ<8 9..0L l3/0 1!$--0T!AaffX&'))224|CcIZ}A./199$$$q$9: 1 99S> !rc (VPV,#)zGet the i-th timing record. Returns ------- res: (name, timings) A named tuple with two fields: - name: str - timings: ProcessedPassTimings r)rrs&&r __getitem__!PassTimingsCollection.__getitem__s}}Qrc ,\VP4#)z#Length of this collection. )lenrrs&r__len__PassTimingsCollection.__len__s4==!!rc"VP4#r4)rrs&r__str__PassTimingsCollection.__str__s||~rrN)r)r&r'r(r)r*r6rrrrr|rpropertyrrrrrr,r-r.s@rrr>ss 00 :  $!! "<  " rr) user_time user_percent system_timesystem_percentuser_system_timeuser_system_percentr{rrfr)rrQr collectionsrcollections.abcr contextlibr functoolsr numba.corerllvmlite.bindingbindingrr r1r@rkr"rrrGrrr s~  "$%%00:00@ "*%Zo(o(d.69*=> YHYr